Bacterial taxon 1392858
Locus CO715_00055
Protein ATI04266.1
iron-sulfur cluster assembly accessory protein
Escherichia coli M12
Length 107 aa, Gene n/a, UniProt n/a
>ATI04266.1|Escherichia coli M12|iron-sulfur cluster assembly accessory protein
MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.08 | 0.0013 | ●●○○○ -1.14 | -1.1389080805558174 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.66 | 0.0039 | ●●○○○ -1.05 | -1.0514854005855445 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)