Bacterial taxon 1392858
Locus CO715_05545
Protein ATI05240.1
IS200/IS605 family transposase ISEc46
Escherichia coli M12
Length 141 aa, Gene n/a, UniProt n/a
>ATI05240.1|Escherichia coli M12|IS200/IS605 family transposase ISEc46
MSNHDDLLAGFLRKRHSVSKLVVHLIFTTKYRRKLFDSQMIAQLREAFGSAAAKLECEIIEMDGEPDHVHLLVAYPPKLAVSVMVNNLKSVSSRLLRQQNAHLRMQSKTGLLWSRSYFVCSTGEATIETLRAYVQSQSTPD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.36 | 2.3e-7 | ●●○○○ -1.41 | -1.4076441469083507 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.15 | 0.0065 | ○○○○○ 1.2 | 1.2041866594588946 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)