Bacterial taxon 1392858
Locus CO715_12295
Protein ATI06417.1
L(+)-tartrate dehydratase subunit beta
Escherichia coli M12
Length 201 aa, Gene n/a, UniProt n/a
>ATI06417.1|Escherichia coli M12|L(+)-tartrate dehydratase subunit beta
MKKILTTPIKAEDLQDIRVGDVIYLTGTLVTCRDVCHRRLIELKRPIPYDLNGKAIFHAGPIVRKNGDKWEMVSVGPTTSMRMESFEREFIEQTGVKLVVGKGGMGPLTEEGCQKFKALHVIFPAGCAVLAATQVEEIEEVHWTELGMPESLWVCRVKEFGPLIVSIDTHGNNLIAENKKLFAERRDPIVEEICEHVHYIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.94 | 4.2e-47 | ●○○○○ -0.49 | -0.4852201179141349 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.77 | 2.0e-7 | ○○○○○ 0.18 | 0.17681368529750183 | 29101196 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)