Bacterial taxon 1392858
Locus CO715_09345
Protein ATI05897.1
LamB/YcsF family protein
Escherichia coli M12
Length 244 aa, Gene n/a, UniProt n/a
>ATI05897.1|Escherichia coli M12|LamB/YcsF family protein
MKIDLNADLGEGYASDAELLTLVSSANIACGFHAGDAQTMQACVREAIKNGVAIGAHPSFPDRENFGRRAMQLPPETVYAQTLYQIGALAAITRAQGGVMCHVKPHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADRGYQADGSLVPRSQPGALIENEEQALEQTLEMVQHGRVKSITGEWATVTAQTVCLHGDGEHALAFARRLRSTFAEKGIVVAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.13 | 0.05 | ○○○○○ 0.78 | 0.7812611885764529 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.15 | 3.3e-9 | ○○○○○ 1.2 | 1.2039780134446458 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)