Bacterial taxon 1392858
Locus CO715_07080
Protein ATI05499.1
lambda prophage-derived protein ea10
Escherichia coli M12
Length 122 aa, Gene n/a, UniProt n/a
>ATI05499.1|Escherichia coli M12|lambda prophage-derived protein ea10
MSNIKKYIIDYDWKASIEIEIDHDVMTEEKLHQINNFWSDSEYRLNKHGSVLNAVLIMLAQHALLIAISSDLNAYGVVCEFDWNDGNGQEGWPPMDGSEGIRITDIDTSGIFDSDDMTIKAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.4 | 8.9e-56 | ●●○○○ -1.62 | -1.6242187096986684 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.06 | 2.2e-27 | ●●○○○ -1.34 | -1.343381174519701 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)