Bacterial taxon 1392858
Locus CO715_03520
Protein ATI04888.1
lysine/arginine/ornithine-binding periplasmic protein
Escherichia coli M12
Length 260 aa, Gene n/a, UniProt n/a
>ATI04888.1|Escherichia coli M12|lysine/arginine/ornithine-binding periplasmic protein
MKKSILALSLLVGLSAAASSYAALPETVRIGTDTTYAPFSSKDAKGDFVGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTVDSLKGKHVGVLQGSTQEAYANETWRSKGVDVVAYANQDLVYSDLAAGRLDAALQDEVAASEGFLKQPAGKDFAFAGSSVKDKKYFGDGTGVGLRKDDAELTAAFNKALGELRQDGTYDKMAKKYFDFNVYGD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.21 | 0.02 | ○○○○○ 0.8 | 0.7987874537733572 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.6 | 0.00099 | ○○○○○ 0.88 | 0.8801593993304131 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)