Bacterial taxon 1392858
Locus CO715_07805
Protein ATI05623.1
lysis protein S
Escherichia coli M12
Length 71 aa, Gene n/a, UniProt n/a
>ATI05623.1|Escherichia coli M12|lysis protein S
MKSMDKLTTGVAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGSLVFGLLTYLTNLYFKIKEDKRKAARGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.02 | 5.7e-7 | ○○○○○ 0.12 | 0.12486082774953534 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.3 | 0.00073 | ○○○○○ 0.82 | 0.8179828870842525 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)