Bacterial taxon 1392858
Locus CO715_14690
Protein ATI06849.1
lysoplasmalogenase
Escherichia coli M12
Length 208 aa, Gene n/a, UniProt n/a
>ATI06849.1|Escherichia coli M12|lysoplasmalogenase
MLWSFIAVCLSAWLSVDASYRGPTWQRWVFKPLTLLLLLLLAWQAPMFDAISYLVLAGLCASLLGDALTLLPRQRLMYAIGAFFLSHLLYTIYFASQMTLSFFWPLPLVLLVLGALLLAIIWTRLEEYRWPICTFIGMTLVMVWLAGELWFFRPTAPALSAFVGASLLFISNFVWLGSHYRRRFRADNAIAAACYFAGHFLIVRSLYL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.7 | 7.2e-8 | ●●○○○ -1.06 | -1.0600398871697478 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.27 | 7.5e-5 | ●○○○○ -0.55 | -0.5524041345022682 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)