Bacterial taxon 1392858
Locus CO715_10350
Protein ATI06063.1
LysR family transcriptional regulator
Escherichia coli M12
Length 297 aa, Gene n/a, UniProt n/a
>ATI06063.1|Escherichia coli M12|LysR family transcriptional regulator
MNIELRHLRYFVAVAEELHFGRAAARLNISQPPLSQQIQALEQQIGARLLARTNRSVLLTAAGKQFLVDSRQILSMVDDAAARAERLHQGEAGELRIGFTSSAPFIRAVSDTLSLFRRDYPDVHLQTREMNTREQIAPLIEGTLDMGLLRNTALPETLEHAVIVHEPLMAMIPHDHPLANNPSVTLAELAKEPFVFFDPHVGTGLYDDILGLMRRYNLTPVITQEVGEAMTIIGLVSAGLGVSILPASFKRVQLNEMRWVPIAEEDAVSEMWLVWPKHHEQSPAARNFRIHLLNALR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.84 | 3.5e-23 | ●●○○○ -1.09 | -1.0894589751788373 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.21 | 7.0e-19 | ○○○○○ 0.08 | 0.08459214699950511 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)