Bacterial taxon 1392858
Locus CO715_24235
Protein ATI08546.1
LysR family transcriptional regulator
Escherichia coli M12
Length 304 aa, Gene n/a, UniProt n/a
>ATI08546.1|Escherichia coli M12|LysR family transcriptional regulator
MKATSEELAIFVSVVESGSFSRAAEQLGQANSAVSRAVKKLEMKLGVSLLNRTTRQLSLTEEGERYFRRVQSILQEMAAAESEIMETRNTPRGLLRIDAATPVVLHFLMPLIKPFRERYPEVTLSLVSSETIINLIERKVDVAIRAGTLTDSSLRARPLFNSYRKIIASPDYISRYGKPETLDDLKQHVCLGFTEPASLNTWPIACSDGQLHEVKYGLSSNSGETLKQLCLSGNGIACLSDYMIDREIARGELVELMADKVLPVEMPFSAVYYSDRAVSTRIRAFIDFLSEHVKTAPGGAVREA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.26 | 6.1e-7 | ●●○○○ -1.18 | -1.1766730091348612 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.89 | 0.0062 | ●○○○○ -0.26 | -0.2644726348388397 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)