Bacterial taxon 1392858
Locus CO715_24580
Protein ATI08605.1
LysR family transcriptional regulator
Escherichia coli M12
Length 294 aa, Gene n/a, UniProt n/a
>ATI08605.1|Escherichia coli M12|LysR family transcriptional regulator
MAKRENYNELYLFMQVVREGSFTAAAQRLGLAQSGVSRSVRELEERLGVQLLVRTTRKLSLTQAGEQLYQKTASGFEMLDLGLATLAHYRETPSGTVRINASQHAIDKCLLPKLAVFKQRYPDIRLELINESRFVDIIEERFDAGVRLGPEVGQGMVAVRITPDMEMAIVGTPEHFRRYGFPQTPADLKAHPCIAYQFADGSVYQWELNQDDKKITHRPEGQWALSDSYMEAEAARLGLGLAYVPVELVADDLEHGKLIRVLQRYSLRMEGLFLYYPHRNVSPALRMVIDTLKI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.03 | 0.00014 | ○○○○○ 0.33 | 0.33121173584165914 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.63 | 0.0005 | ○○○○○ 0.42 | 0.4155047255981991 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)