Bacterial taxon 1392858
Locus CO715_12440
Protein ATI06443.1
M48 family peptidase
Escherichia coli M12
Length 167 aa, Gene n/a, UniProt n/a
>ATI06443.1|Escherichia coli M12|M48 family peptidase
MSNLTYLQGYPEHLLSQVRTLINEQRLGDVLAKRYPGTHDYSTDKALWQYTQDLKNQFLRNAPPITKVMYDNKIHVLKNALGLHTAVSRVQGGKLKAKAEIRVATVFRNAPEPFLRMIVVHELAHLKEKEHNKAFYQLCCHMEPQYHQLEFDTRLWLTQLSLGQDKI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.78 | 0.014 | ●●○○○ -1.91 | -1.9119415633478483 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -11.36 | 0.027 | ●●○○○ -1.82 | -1.8243102373633266 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)