Bacterial taxon 1392858
Locus CO715_01525
Protein ATI04527.1
membrane protein FxsA
Escherichia coli M12
Length 158 aa, Gene n/a, UniProt n/a
>ATI04527.1|Escherichia coli M12|membrane protein FxsA
MRWLPFIAIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMSLVRNQGFKNFVLMQQKMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPVQKHLTVKLMPHLRFSRMPGGGFSAGTGGGNTFDGEYQRKDDDRDRLDHKDDRQD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.21 | 0.00012 | ○○○○○ 0.8 | 0.799204745801855 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.94 | 5.8e-20 | ○○○○○ 1.16 | 1.1591191203811408 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)