Bacterial taxon 1392858
Locus CO715_06915
Protein ATI05469.1
metal ABC transporter permease
Escherichia coli M12
Length 285 aa, Gene n/a, UniProt n/a
>ATI05469.1|Escherichia coli M12|metal ABC transporter permease
MMALLLEPLQFTFMSHALLISLVVSIPCALLSVFLVLKGWALMGDAMSHAVFPGIVLAWILGLPLATGAFVAGVFCAVATGYLKDNSRIKQDTVMGIVFSGMFAAGLILYIAVKPDVHLDHILFGDMLGITIGDIIQTMIIAGLVTLVISVKWRDFLLFSFDYQQAQVSGLHTRWLHYGLLCMVSLTIVATLKAVGIILSISLLIAPGAIAVLLTQRFHIALLLATGISVIVSMTGVWLSFFIDSAPAPTIVVLFAVLFIMTFAVTSINARKKGNSHTQDLLSPN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.44 | 2.3e-5 | ●●○○○ -1.63 | -1.6323559042543743 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.42 | 8.3e-5 | ●●○○○ -1.21 | -1.2100563714146788 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)