Bacterial taxon 1392858
Locus CO715_19280
Protein ATI07669.1
methylated-DNA--[protein]-cysteine S-methyltransferase
Escherichia coli M12
Length 171 aa, Gene n/a, UniProt n/a
>ATI07669.1|Escherichia coli M12|methylated-DNA--[protein]-cysteine S-methyltransferase
MLRLLEEKIVTPLGPLWVICDEQFRLRAVEWEEYSERMVQLLDIHYRKEGYERISATNPGGLSDKLREYFAGNLSIIDTLPTATGGTPFQREVWKTLRTIPCGQVMHYGQLAEQLGRPGAARAVGAANGSNPISIVVPCHRVIGRNGTMTGYAGGVQRKEWLLRHEGYLLL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.05 | 0.0024 | ●●○○○ -1.34 | -1.3421292984342084 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.27 | 0.022 | ●○○○○ -0.97 | -0.9696961629999907 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)