Bacterial taxon 1392858
Locus CO715_15560
Protein ATI07003.1
methylenetetrahydrofolate reductase
Escherichia coli M12
Length 296 aa, Gene n/a, UniProt n/a
>ATI07003.1|Escherichia coli M12|methylenetetrahydrofolate reductase
MSFFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSNLKPKFVSVTYGANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPPGSGKPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPGL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.51 | 4.0e-13 | ●●○○○ -1.23 | -1.2284172206685788 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.24 | 2.7e-6 | ●○○○○ -0.55 | -0.5467706921175491 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)