Bacterial taxon 1392858
Locus CO715_12335
Protein ATI06425.1
mismatch-specific DNA-glycosylase
Escherichia coli M12
Length 168 aa, Gene n/a, UniProt n/a
>ATI06425.1|Escherichia coli M12|mismatch-specific DNA-glycosylase
MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.83 | 8.1e-6 | ●●○○○ -1.09 | -1.0875811610505974 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.2 | 0.0013 | ○○○○○ 1.21 | 1.21420166814284 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)