Bacterial taxon 1392858
Locus CO715_11365
Protein ATI06250.1
MltA-interacting protein
Escherichia coli M12
Length 248 aa, Gene n/a, UniProt n/a
>ATI06250.1|Escherichia coli M12|MltA-interacting protein
MTKLKLLALGVLIATSAGVAHAEGKFSLGAGVGVVEHPYKDYDTDVYPVPVINYEGDNFWFRGLGGGYYLWNDATDKLSITAYWSPLYFKAKDSGDHQMRHLDDRKSTMMAGLSYAHFTQYGYLRTTLAGDTLDNSNGIVWDMAWLYRYTNGGLTVTPGIGVQWNSENQNEYYYGVSRKESARSGLRGYNPNDSWSPYLELSASYNFLGDWSVYGTARYTRLSDEVTDSPMVDKSWTGLISTGITYKF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.09 | 0.0019 | ○○○○○ 0.32 | 0.3180670369439809 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.7 | 1.8e-45 | ○○○○○ 1.53 | 1.5259188134306387 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)