Bacterial taxon 1392858
Locus CO715_12500
Protein ATI06452.1
modulator protein MzrA
Escherichia coli M12
Length 127 aa, Gene n/a, UniProt n/a
>ATI06452.1|Escherichia coli M12|modulator protein MzrA
MQIPRMSLRQLAWSGAVLLLVGTLLLAWSAVRQQESTLAIRAVHQGTTMPDGFSIWHHLDAHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIAQQDNNSQAMQWLTRLRDNSHRFG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.64 | 3.0e-5 | ●●○○○ -1.05 | -1.0487730024003092 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.18 | 0.00011 | ●○○○○ -0.95 | -0.9509180217175932 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)