Bacterial taxon 1392858
Locus CO715_09010
Protein ATI05844.1
molybdate ABC transporter substrate-binding protein
Escherichia coli M12
Length 257 aa, Gene n/a, UniProt n/a
>ATI05844.1|Escherichia coli M12|molybdate ABC transporter substrate-binding protein
MARKWLNLFAGAALSFAVAGNALADEGKITVFAAASLTNAMQDIATQYKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASEQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTTK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.93 | 0.023 | ○○○○○ 0.74 | 0.7403665697836761 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.05 | 9.1e-16 | ○○○○○ 1.18 | 1.1833220580340087 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)