Bacterial taxon 1392858
Locus CO715_10810
Protein ATI06144.1
murein L,D-transpeptidase
Escherichia coli M12
Length 334 aa, Gene n/a, UniProt n/a
>ATI06144.1|Escherichia coli M12|murein L,D-transpeptidase
MKRASLLTLTLIGAFSAIQAAWAVDYPLPPTGSRLVGQNQTYTVQEGDKNLQAIARRFDTAAMLILEANNTIAPVPKPGTTITIPSQLLLPDAPRQGIIVNLAELRLYYYPPGENIVQVYPIGIGLQGLETPVMETRVGQKIPNPTWTPTAGIRQRSLERGIKLPPVVPAGPNNPLGRYALRLAHGNGEYLIHGTSAPDSVGLRVSSGCIRMNAPDIKALFSSVRTGTPVKVINEPVKYSVEPNGMRYVEVHRPLSAEEQQNVQTMPYTLPAGFTQFKDNKGVDQKLVDKALYRRAGYPVSVSSGATPAASNAPSVESAQNGEPEQGNMLRATQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.03 | 2.5e-22 | ●●○○○ -1.34 | -1.33816502416348 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.07 | 3.4e-21 | ●●○○○ -1.14 | -1.1366129743990796 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)