Bacterial taxon 1392858
Locus CO715_06660
Protein ATI05424.1
murein transglycosylase
Escherichia coli M12
Length 203 aa, Gene n/a, UniProt n/a
>ATI05424.1|Escherichia coli M12|murein transglycosylase
MKLRWFAFLIVLLAGCSSKHDYTNPPWNAKVPVQRAMQWMPISQKAGAAWGVDPQLITAIIAIESGGNPNAVSKSNAIGLMQLKASTSGRDVYRRMGWSGEPTTSELKNPERNISMGAAYLNILETGPLAGIEDPKVLQYALVVSYANGAGALLRTFSSDRKKAISKINDLDADEFLDHVARNHPAPQAPRYIYKLEQALDAM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.68 | 0.00014 | ●●○○○ -1.27 | -1.2657648572191247 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.26 | 0.00056 | ●●○○○ -1.18 | -1.178133531234603 | 29101196 |
Retrieved 2 of 2 entries in 9.2 ms
(Link to these results)