Bacterial taxon 1392858
Locus CO715_05050
Protein ATI05155.1
NAD(P)-dependent oxidoreductase
Escherichia coli M12
Length 274 aa, Gene n/a, UniProt n/a
>ATI05155.1|Escherichia coli M12|NAD(P)-dependent oxidoreductase
MKKVAIVGLGWLGMPLAMSLSARGWQVTGSKTTQDGVEAARMSGIDSYLLRMEPELVCDSDDLDALMDADALVITLPARRSGPGDEFYLQAVQELVDSALAHRIPRIIFTSSTSVYGDAQGTVKETTPRNPVTNSGRVLEELEDWLHNLPGTSVDILRLAGLVGPGRHPGRFFAGKTAPDGEHGVNLVHLEDVIGAITLLLQAPKGGHIYNICAPAHPARNVFYPQMARLLGLEPPQFRNSLDSGKGKIIDGSRICNELGFEYQYPDPLVMPLE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.46 | 2.1e-35 | ●●○○○ -1.43 | -1.427048226233495 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.01 | 2.6e-11 | ●○○○○ -0.29 | -0.29055338661994734 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)