Bacterial taxon 1392858
Locus CO715_11275
Protein ATI06233.1
NAD(P)H nitroreductase
Escherichia coli M12
Length 183 aa, Gene n/a, UniProt n/a
>ATI06233.1|Escherichia coli M12|NAD(P)H nitroreductase
MDALELLINRRSASRLAEPAPTGEQLQNILRAGMRAPDHKSMQPWHFFVIEGEGRERFSAVLEQGAIAAGSDDKAIDKARNAPYRAPLIITVVAKCEENHKVPRWEQEMSAGCAVMAMQMAAVAQGFGGIWRSGALTESPVVREAFGCREQDKIVGFLYLGTPQLKASTSINVPDPTPFVTYF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.6 | 5.0e-55 | ●●○○○ -1.04 | -1.0400098698018572 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.62 | 6.4e-22 | ●○○○○ -0.21 | -0.20813821099164725 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)