Bacterial taxon 1392858
Locus CO715_17355
Protein ATI07329.1
NADPH-dependent 7-cyano-7-deazaguanine reductase QueF
Escherichia coli M12
Length 282 aa, Gene n/a, UniProt n/a
>ATI07329.1|Escherichia coli M12|NADPH-dependent 7-cyano-7-deazaguanine reductase QueF
MSSYANHQVLAGLTLGKSTDYRDTYDASLLQGVPRSLNRDPLGLKADNLPFHGTDIWTLYELSWLNAKGLPQVAVGHVELDYTSANLIESKSFKLYLNSFNQTRFNNWDEVRQTLERDLSTCAQGKVSVALYRLDELEGQPIGHFNGTCIDDQDITIDNYEFTTDYLENATSGEKVVEETLVSHLLKSNCLITHQPDWGSIQIQYRGRQIDREKLLRYLVSFRHHNEFHEQCVERIFNDLLRFCQPEKLSVYARYTRRGGLDINPWRSNSDFVPSTTRLVRQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.84 | 9.0e-17 | ●○○○○ -0.05 | -0.046437549948779695 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.36 | 1.9e-11 | ○○○○○ 0.05 | 0.054547120947669156 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)