Bacterial taxon 1392858
Locus CO715_11295
Protein ATI06236.1
nicotinamidase/pyrazinamidase
Escherichia coli M12
Length 213 aa, Gene n/a, UniProt n/a
>ATI06236.1|Escherichia coli M12|nicotinamidase/pyrazinamidase
MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGSFASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLNQKAIAAVFHKGENPLVDSYSAFFDNGRRQKTTLDDWLRDHEIDELIIMGLATDYCVKFTVLDALQLGYKVNVITDGCRGVNIQPQDSAHAFMEMSAAGATLYTLADWEETQE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.32 | 2.8e-6 | ●●○○○ -1.4 | -1.3992983063383961 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.23 | 0.021 | ●○○○○ -0.34 | -0.33624686374044804 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)