Bacterial taxon 1392858
Locus CO715_20545
Protein ATI07903.1
nitroreductase family protein
Escherichia coli M12
Length 196 aa, Gene n/a, UniProt n/a
>ATI07903.1|Escherichia coli M12|nitroreductase family protein
MNEAVSPGALSTLFTDARTHNGWRETPVSDETLREIYALMKWGPTSANCSPARIVFIRTAEGKERLRPALSSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFTSSPQLAEETAFRNSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAFFTGSTLKSNLLINIGYGDSSKLYARLPRLSFEEACGLL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.76 | 3.1e-5 | ●●○○○ -1.28 | -1.280787370245043 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.37 | 0.0038 | ●○○○○ -0.57 | -0.5745206120126477 | 29101196 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)