Bacterial taxon 1392858
Locus CO715_14350
Protein ATI06783.1
outer membrane protein slp
Escherichia coli M12
Length 188 aa, Gene n/a, UniProt n/a
>ATI06783.1|Escherichia coli M12|outer membrane protein slp
MNMTKGALILSLSFLLAACSSIPQNIKGNNQPDIQKSFVAVHNQPGLYVGQQARFGGKVINVINGKTDTLLEIAVLPLDSYAKPDIEANYQGRLLARQSGFLDPVNYRNHFVTILGTIQGEQPGFINKVPYNFLEVNMQGIQVWHLREVVNTTYNLWDYGYGAFWPEPGWGAPYYTNAVSQVTPELVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.48 | 0.0036 | ○○○○○ 0.65 | 0.6458499253289419 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.3 | 8.9e-15 | ○○○○○ 0.82 | 0.8181915330985013 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)