Bacterial taxon 1392858
Locus CO715_08735
Protein ATI05793.1
outer membrane protein X
Escherichia coli M12
Length 171 aa, Gene n/a, UniProt n/a
>ATI05793.1|Escherichia coli M12|outer membrane protein X
MKKIACLSALAAVLAFTAGTSVAATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.03 | 1.0e-6 | ○○○○○ 0.97 | 0.9690426014004281 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.29 | 8.9e-15 | ○○○○○ 1.23 | 1.2325625173967398 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)