Bacterial taxon 1392858
Locus CO715_10515
Protein ATI06093.1
oxidoreductase
Escherichia coli M12
Length 346 aa, Gene n/a, UniProt n/a
>ATI06093.1|Escherichia coli M12|oxidoreductase
MSDNIRVGLIGYGYASKTFHAPLIAGTPGLELAVISSSDETKVKADWPTVTVVSEPKHLFNDPNIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPFTVTLSQARELEALAKSLGRVLSVFHNRRWDSDFLTLKGLLAEGVLGEVAYFESHFDRFRPQVRDRWREQGGPGSGIWYDLAPHLLDQAITLFGLPVSMTVDLAQLRPGAQSTDYFHAILSYPQRRVILHGTMLAAAESARYIVHGSRGSYVKYGLDPQEERLKNGERLPQEDWGYDMRDGVLTRVEGEERVEETLLTVPGNYPAYYAAIRDALNGDGENPVPASQAIQVMELIELGIESAKHRATLCLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.96 | 4.0e-15 | ●○○○○ -0.91 | -0.9058504826398391 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.57 | 0.031 | ○○○○○ 0.87 | 0.8741086649171962 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)