Bacterial taxon 1392858
Locus CO715_17250
Protein ATI07310.1
oxidoreductase
Escherichia coli M12
Length 261 aa, Gene n/a, UniProt n/a
>ATI07310.1|Escherichia coli M12|oxidoreductase
MSIESLNAFSMDFFSLKGKTAIVTGGNSGLGQAFAMALAKAGANIFIPSFVKDNGETKEMIEKQGVEVDFMQVDITAEGAPQKIIAACCERFGTVDILINNAGICKLNKVLDFGRADWDPMIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYLGGQWSPAYSATKHALAGFTKAYCDELGQYNIQVNGIAPGYYATDITLATRSNPETNQRVLDHIPANRWGDTQDLMGAAVFLASPASNYVNGHLLVVDGGYLVR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.39 | 2.4e-20 | ●●○○○ -1.2 | -1.2048402210584572 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.37 | 0.036 | ○○○○○ 0.83 | 0.8315448780104285 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)