Bacterial taxon 1392858
Locus CO715_21025
Protein ATI07992.1
penicillin-binding protein activator LpoB
Escherichia coli M12
Length 213 aa, Gene n/a, UniProt n/a
>ATI07992.1|Escherichia coli M12|penicillin-binding protein activator LpoB
MTKMSRYALITALAMFLAGCVGQREPAPVEEVKPAPEQPAEPQQPVPTVPSVPTIPQQPGPIEHEDQTAPPAPHIRHYDWNGAMQPMVSKMLGADGVTAGSVLLVDSVNNRTNGSLNAAEATETLRNALANNGKFTLVSAQQLSMAKQQLGLSPQDSLGTRSKAIGIARNVGAHYVLYSSASGNVNAPTLQMQLMLVQTGEIIWSGKGAVSQQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.21 | 3.1e-198 | ●○○○○ -0.96 | -0.9580119862020545 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.6 | 1.3e-149 | ●○○○○ -0.62 | -0.6229264873183833 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)