Bacterial taxon 1392858
Locus CO715_03425
Protein ATI04870.1
penicillin-insensitive murein endopeptidase
Escherichia coli M12
Length 274 aa, Gene n/a, UniProt n/a
>ATI04870.1|Escherichia coli M12|penicillin-insensitive murein endopeptidase
MNKTAIALLALLASSASLAATPWQKITQPVPGSAQSIGSFSNGCIVGADTLPIQSEHYQVMRTDQRRYFGHPDLVMFIQRLSSQVSNLSLGTVLIGDMGMPAGGRFNGGHASHQTGLDVDIFLQLPKTRWTSAQLLRPQALDLVSRDGKHVVPTLWKPEIFSLIKLAAQDKDVTRIFVNPAIKQQLCLDAGTDRDWLRKVRPWFQHRAHMHVRLRCPADSLECEDQPLPPPGDGCGAELQSWFEPPKPGTTKPEKKTPPPLPPSCQALLDEHVI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.89 | 5.5e-15 | ○○○○○ 0.94 | 0.9402494514340852 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.95 | 2.5e-33 | ○○○○○ 1.16 | 1.1624574566091226 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)