Bacterial taxon 1392858
Locus CO715_04085
Protein ATI04993.1
peptidylprolyl isomerase A
Escherichia coli M12
Length 190 aa, Gene n/a, UniProt n/a
>ATI04993.1|Escherichia coli M12|peptidylprolyl isomerase A
MFKSTLAAMAAVFALSALSPAAMAAKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDIADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.36 | 8.9e-5 | ●●○○○ -1.2 | -1.197537610559747 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.73 | 0.00059 | ●○○○○ -0.65 | -0.6485899470709933 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)