Bacterial taxon 1392858
Locus CO715_21205
Protein ATI08886.1
periplasmic nitrate reductase subunit alpha
Escherichia coli M12
Length 239 aa, Gene n/a, UniProt n/a
>ATI08886.1|Escherichia coli M12|periplasmic nitrate reductase subunit alpha
TLYEVLYATPEVSKFPVSELAEDQLNDESRELGFYLQKGLFEEYAWFGRGHGHDLAPFDDYHKARGLRWPVVNGKETQWRYSEGNDPYVKAGEGYKFYGKPDGKAVIFALPFEPAAEAPDEEYDLWLSTGRVLEHWHTGSMTRRVPELHRAFPEAVLFIHPLDAKARDLRRGDKVKVVSRRGEVISIVETRGRNRPPQGLVYMPFFDAAQLVNKLTLDATDPLSKETDFKKCAVKLEKV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.21 | 5.1e-9 | ○○○○○ 0.08 | 0.08438350098525627 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.13 | 0.0021 | ○○○○○ 0.31 | 0.3111817184737685 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)