Bacterial taxon 1392858
Locus CO715_05835
Protein ATI05285.1
phage minor tail protein L
Escherichia coli M12
Length 232 aa, Gene n/a, UniProt n/a
>ATI05285.1|Escherichia coli M12|phage minor tail protein L
MQDIRQETLNECTRAEQSASVVLWEIDLTEVGGERYFFCNEQNEKGEPVTWQGRQYQPYPIQGSGFELNGKGTSTRPTLTVSNLYGMVTGMAEDMQSLVGGTVVRRKVYARFLDAVNFVNGNSYADPEQEVISRWRIEQCSELSAVSASFVLSTPTETDGAVFPGRIMLANTCTWTYRGDECGYSGPAVADEYDQPTSDITKDKCSKCLSGCKFRNNVGNFGGFLSINKLSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.51 | 2.1e-21 | ●●○○○ -1.44 | -1.4389410490456795 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.92 | 2.5e-23 | ●○○○○ -0.9 | -0.8972959960556359 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)