Bacterial taxon 1392858
Locus CO715_05795
Protein ATI05280.1
phage tail protein
Escherichia coli M12
Length 117 aa, Gene n/a, UniProt n/a
>ATI05280.1|Escherichia coli M12|phage tail protein
MADFDNLFDAAIARADETIRGYMGTSATMTSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPFLFVRTDDVRQLRRGDTLTIGEENFWIDRISPDDGGSCHLWLGRGVPPAVNRRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.85 | 3.3e-12 | ●●○○○ -1.3 | -1.300191449570187 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.32 | 0.0012 | ●○○○○ -0.15 | -0.14575305273123765 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)