Bacterial taxon 1392858
Locus CO715_03370
Protein ATI04859.1
phosphohistidine phosphatase
Escherichia coli M12
Length 161 aa, Gene n/a, UniProt n/a
>ATI04859.1|Escherichia coli M12|phosphohistidine phosphatase
MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELTPCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLKMAKAI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.78 | 1.0e-6 | ●●○○○ -1.28 | -1.2849602905300201 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.3 | 0.0058 | ●○○○○ -0.14 | -0.1419974244747582 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)