Bacterial taxon 1392858
Locus CO715_12980
Protein ATI06540.1
phospholipid ABC transporter-binding protein
Escherichia coli M12
Length 97 aa, Gene n/a, UniProt n/a
>ATI06540.1|Escherichia coli M12|phospholipid ABC transporter-binding protein
MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.78 | 1.3e-35 | ●●○○○ -1.08 | -1.0779834443951497 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.48 | 5.7e-13 | ○○○○○ 1.06 | 1.0631419538266644 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)