Bacterial taxon 1392858
Locus CO715_14845
Protein ATI06878.1
pirin family protein
Escherichia coli M12
Length 231 aa, Gene n/a, UniProt n/a
>ATI06878.1|Escherichia coli M12|pirin family protein
MIYLRKANERGHANHGWLDSWHTFSFANYYDPNFMGFSALRVINDDVIEAGQGFGTHPHKDMEILTYVLEGTVEHQDSMGNKEQVPAGEFQIMSAGTGIRHSEYNPSSTERLHLYQIWIMPEENGITPRYEQRRFDAVQGKQLVLSPDARDGSLKVYQDMELYRWALVKDEQSVHQIAAERRVWIQVVKGNVTINGVKASTSDGLAIWDEQAISIHADSDSEVLLFDLPPV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.12 | 3.7e-28 | ●●○○○ -1.15 | -1.148088505182767 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.13 | 0.02 | ○○○○○ 0.78 | 0.782513064661946 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)