Bacterial taxon 1392858
Locus CO715_08795
Protein ATI05803.1
PKHD-type hydroxylase
Escherichia coli M12
Length 225 aa, Gene n/a, UniProt n/a
>ATI05803.1|Escherichia coli M12|PKHD-type hydroxylase
MMYHIPGVLSPKDVARFREQLEQAEWVDGRVTTGAQGAQVKNNQQVDTRSALYAALQNEVLNAVNQHALFFAAALPHTLSTPLFNRYQNNETYGFHVDGAVRSHPQNGWMRTDLSATLFLSDPQSYDGGELVVNDTFGQHRVKLPAGDLVLYPSSSLHCVTPVTRGVRVASFMWIQSMIRDDKKRAMLFDLDNNIQSLKSRYGESEEILSLLNLYHNLLREWSEI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.87 | 4.5e-5 | ●●○○○ -1.1 | -1.095718355606303 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.52 | 0.00015 | ●●○○○ -1.02 | -1.0222749585907038 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)