Bacterial taxon 1392858
Locus CO715_04020
Protein ATI04980.1
PRD domain-containing protein
Escherichia coli M12
Length 120 aa, Gene n/a, UniProt n/a
>ATI04980.1|Escherichia coli M12|PRD domain-containing protein
METRLNLLCDAGVIDKDICKGMMQVVNLLETECHLPVRSEQGMMAMTHMASALMRSRRGEEIEPLDAELLAELAQSSHWQAVVQLHQVLLKEFTLEVNPCEEGYLLANLYGLWMAANEEV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.8 | 9.5e-5 | ●●○○○ -1.71 | -1.7070511773554664 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.01 | 0.0017 | ●●○○○ -1.33 | -1.3337834578642536 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)