Bacterial taxon 1392858
Locus CO715_23045
Protein ATI08350.1
protein FimG
Escherichia coli M12
Length 167 aa, Gene n/a, UniProt n/a
>ATI08350.1|Escherichia coli M12|protein FimG
MKWCKRGYVLAAILALASATIQAADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.13 | 2.6e-27 | ●●○○○ -1.15 | -1.1499663193110068 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.34 | 0.043 | ○○○○○ 0.27 | 0.26653147142451217 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)