Bacterial taxon 1392858
Locus CO715_10090
Protein ATI06025.1
protein GnsB
Escherichia coli M12
Length 57 aa, Gene n/a, UniProt n/a
>ATI06025.1|Escherichia coli M12|protein GnsB
MNIEELKTKTEADISEYITKKIIELKKKTGKEVTSIQFTAREKMTGLESYDIKIDLI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.98 | 1.4e-7 | ●●○○○ -1.33 | -1.3281500154795345 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.93 | 8.7e-8 | ●○○○○ -0.9 | -0.9002170402551201 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)