Bacterial taxon 1392858
Locus CO715_23830
Protein ATI08472.1
protein HokE
Escherichia coli M12
Length 50 aa, Gene n/a, UniProt n/a
>ATI08472.1|Escherichia coli M12|protein HokE
MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.96 | 1.3e-5 | ●●○○○ -1.11 | -1.1144964968887003 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.48 | 0.0021 | ●○○○○ -0.18 | -0.17934506102530431 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)