Bacterial taxon 1392858
Locus CO715_21910
Protein ATI08151.1
protein phosphatase 2C domain-containing protein
Escherichia coli M12
Length 253 aa, Gene n/a, UniProt n/a
>ATI08151.1|Escherichia coli M12|protein phosphatase 2C domain-containing protein
MSWRLVYASTVGTSHISADLPCQDACQMQVAWLNDQQPLLSVFVADGAGSVSQGGEGAMLAVNEAMAYMSQKVQGGELGLNDVLATDIVLTIRQRLFAEAEAKELAVRDFACTFLGLISSPDGTLIMQIGDGGVVVDLGHGLQLPLTPMVGEYANMTHFITDEDAVSRLETFTSTERAHKVAAFTDGIQRLALNMLDNSPHVPFFTPFFNGLASATQEQLDLLPELLKQFLSGPAVNERTDDDKTLALALWTE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.47 | 0.00015 | ●●○○○ -1.43 | -1.4305952084757254 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.05 | 0.00055 | ●●○○○ -1.34 | -1.3429638824912036 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)