Bacterial taxon 1392858
Locus CO715_06725
Protein ATI05436.1
protein UmuD
Escherichia coli M12
Length 139 aa, Gene n/a, UniProt n/a
>ATI05436.1|Escherichia coli M12|protein UmuD
MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITISSEDTLDVFGVVIHVVKAMR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.71 | 2.0e-6 | ●●○○○ -1.48 | -1.4787924377672124 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.44 | 8.5e-6 | ●●○○○ -1.22 | -1.2156898137993983 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)