Bacterial taxon 1392858
Locus CO715_13045
Protein ATI06552.1
PTS IIA-like nitrogen regulatory protein PtsN
Escherichia coli M12
Length 163 aa, Gene n/a, UniProt n/a
>ATI06552.1|Escherichia coli M12|PTS IIA-like nitrogen regulatory protein PtsN
MTNNDTTLQLSSVLNRECTRSRVHCQSKKRALEIISELAAKQLSLPPQVVFEAILTREKMGSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTHLHTLSLVAKRLADKTICRRLRAAQSDEELYQIITDTEGTPDEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.77 | 0.024 | ○○○○○ 1.54 | 1.54219320254205 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 5.04 | 0.026 | ○○○○○ 1.6 | 1.5981103343607446 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)