Bacterial taxon 1392858
Locus CO715_11115
Protein ATI06203.1
PTS N N'-diacetylchitobiose transporter subunit IIA
Escherichia coli M12
Length 116 aa, Gene n/a, UniProt n/a
>ATI06203.1|Escherichia coli M12|PTS N N'-diacetylchitobiose transporter subunit IIA
MMDLDNIPDTQTEAEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRIALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQDHLMTSMLARELITELIELHEKLKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.75 | 3.9e-11 | ●●○○○ -1.07 | -1.0704721878821908 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.73 | 1.5e-20 | ○○○○○ 1.53 | 1.5330127779151002 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)