Bacterial taxon 1392858
Locus CO715_14515
Protein ATI06816.1
PTS sugar transporter subunit IIB
Escherichia coli M12
Length 93 aa, Gene n/a, UniProt n/a
>ATI06816.1|Escherichia coli M12|PTS sugar transporter subunit IIB
MSQTILFVCATGIATSTAVTEKVMEYCKEHGLNVNYSQTNVASLPGNTDGVALVVSTTKVPYELDVPVVNGLPIITGIGEEKVLAQIVSILKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.7 | 1.2e-17 | ○○○○○ 0.19 | 0.1907929682521755 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.46 | 0.0069 | ○○○○○ 0.24 | 0.24149394971464883 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)